GSTA4 antibody (C-Term)

Catalog No. ABIN631150

Product Details anti-GSTA4 Antibody

Target: GSTA4 (Glutathione S-Transferase alpha 4 (GSTA4))

Binding Specificity: C-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This GSTA4 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: GSTA4 antibody was raised against the C terminal of GSTA4

Purification: Affinity purified

Immunogen: GSTA4 antibody was raised using the C terminal of GSTA4 corresponding to a region with amino acids LSAFPFLQEYTVKLSNIPTIKRFLEPGSKKKPPPDEIYVRTVYNIFRP

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

GSTA4 Blocking Peptide, catalog no. 33R-5405, is also available for use as a blocking control in assays to test for specificity of this GSTA4 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GSTA4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for GSTA4

Target: GSTA4 (Glutathione S-Transferase alpha 4 (GSTA4))

Alternative Name: GSTA4 (GSTA4 Products)

Synonyms: GSTA4-4 antibody, GTA4 antibody, gsta4-4 antibody, gta4 antibody, tGSTA4 antibody, GST5.7 antibody, mGsta4 antibody, glutathione S-transferase alpha 4 antibody, glutathione S-transferase alpha 4-like antibody, glutathione S-transferase alpha 4 S homeolog antibody, glutathione S-transferase 3 antibody, glutathione S-transferase, alpha 4 antibody, glutathione S-transferase A4 antibody, GSTA4 antibody, Gsta4 antibody, GSTA4L antibody, gsta4 antibody, gsta4.S antibody, LOC100341622 antibody

Background: GSTA4 is a glutathione S-tranferase belonging to the alpha class. The alpha class genes, which are located in a cluster on chromosome 6, are highly related and encode enzymes with glutathione peroxidase activity that function in the detoxification of lipid peroxidation products. Reactive electrophiles produced by oxidative metabolism have been linked to a number of degenerative diseases including Parkinson's disease, Alzheimer's disease, cataract formation, and atherosclerosis.

Molecular Weight: 26 kDa (MW of target protein)