Peripherin antibody (Middle Region)

Catalog No. ABIN631186

Product Details anti-Peripherin Antibody

Target: Peripherin (PRPH)

Binding Specificity: Middle Region

Reactivity: Human, Rat, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Peripherin antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: PRPH antibody was raised against the middle region of PRPH

Purification: Affinity purified

Immunogen: PRPH antibody was raised using the middle region of PRPH corresponding to a region with amino acids YKSKYADLSDAANRNHEALRQAKQEMNESRRQIQSLTCEVDGLRGTNEAL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PRPH Blocking Peptide, catalog no. 33R-10156, is also available for use as a blocking control in assays to test for specificity of this PRPH antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PRPH antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Peripherin

Target: Peripherin (PRPH)

Alternative Name: PRPH (PRPH Products)

Synonyms: NEF4 antibody, PRPH1 antibody, Prph1 antibody, Perf antibody, nef4 antibody, prph1 antibody, MGC69454 antibody, if3 antibody, plasticin antibody, zgc:111926 antibody, peripherin antibody, peripherin L homeolog antibody, PRPH antibody, Prph antibody, prph antibody, prph.L antibody

Background: This gene encodes a cytoskeletal protein found in neurons of the peripheral nervous system. The encoded protein is a type III intermediate filament protein with homology to other cytoskeletal proteins such as desmin.

Molecular Weight: 54 kDa (MW of target protein)