LONRF3 antibody (Middle Region)

Catalog No. ABIN631189

Product Details anti-LONRF3 Antibody

Target: LONRF3 (LON Peptidase N-terminal Domain and Ring Finger 3 (LONRF3))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This LONRF3 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: LONRF3 antibody was raised against the middle region of LONRF3

Purification: Affinity purified

Immunogen: LONRF3 antibody was raised using the middle region of LONRF3 corresponding to a region with amino acids LEIRNVQFFADGRSVVDSIGKRRFRVLHQSQRDGYNTADIEYIEDQKVQG

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

LONRF3 Blocking Peptide, catalog no. 33R-4906, is also available for use as a blocking control in assays to test for specificity of this LONRF3 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LONRF3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for LONRF3

Target: LONRF3 (LON Peptidase N-terminal Domain and Ring Finger 3 (LONRF3))

Alternative Name: LONRF3 (LONRF3 Products)

Synonyms: RNF127 antibody, 4932412G04Rik antibody, 5730439E01Rik antibody, A830039N02Rik antibody, AU023707 antibody, Rnf127 antibody, RGD1565451 antibody, LON peptidase N-terminal domain and ring finger 3 antibody, LONRF3 antibody, Lonrf3 antibody

Background: LONRF3 contains a RING finger domain, a motif present in a variety of functionally distinct proteins and known to be involved in protein-protein and protein-DNA interactions. Multiple alternatively spliced transcript variants have been suggested, but their full length natures are not clear.

Molecular Weight: 84 kDa (MW of target protein)