NEDD4-2 antibody (Middle Region)

Catalog No. ABIN631206

Product Details anti-NEDD4-2 Antibody

Target: NEDD4-2 (NEDD4L) (E3 ubiquitin-protein ligase NEDD4-like (NEDD4L))

Binding Specificity: Middle Region

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This NEDD4-2 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: NEDD4 L antibody was raised against the middle region of NEDD4

Purification: Affinity purified

Immunogen: NEDD4 L antibody was raised using the middle region of NEDD4 corresponding to a region with amino acids TVTLSAPLEGAKDSPVRRAVKDTLSNPQSPQPSPYNSPKPQHKVTQSFLP

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

NEDD4L Blocking Peptide, catalog no. 33R-9373, is also available for use as a blocking control in assays to test for specificity of this NEDD4L antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NEDD0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for NEDD4-2

Target: NEDD4-2 (NEDD4L) (E3 ubiquitin-protein ligase NEDD4-like (NEDD4L))

Alternative Name: NEDD4L (NEDD4L Products)

Synonyms: NEDD4-2 antibody, NEDD4.2 antibody, RSP5 antibody, hNEDD4-2 antibody, nedd4 antibody, nedd4-2 antibody, NEDD4 antibody, Nedd4-2 antibody, 1300012C07Rik antibody, Nedd4b antibody, neural precursor cell expressed, developmentally down-regulated 4-like, E3 ubiquitin protein ligase antibody, NEDD4L antibody, neural precursor cell expressed, developmentally down-regulated 4-like, E3 ubiquitin protein ligase S homeolog antibody, neural precursor cell expressed, developmentally down-regulated gene 4-like antibody, NEDD4L antibody, LOC776799 antibody, nedd4l.S antibody, Nedd4l antibody

Background: NEDD4L is an E3 ubiquitin-protein ligase which accepts ubiquitin from an E2 ubiquitin-conjugating enzyme in the form of a thioester and then directly transfers the ubiquitin to targeted substrates. NEDD4L inhibits TGF-beta signaling by triggering SMAD2 and TGFR1 ubiquitination and proteasome-dependent degradation.

Molecular Weight: 110 kDa (MW of target protein)

Pathways: Negative Regulation of Transporter Activity