PKC zeta antibody (N-Term)

Catalog No. ABIN631227

Product Details anti-PKC zeta Antibody

Target: PKC zeta (PRKCZ) (Protein Kinase C, zeta (PRKCZ))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PKC zeta antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: PRKCZ antibody was raised against the N terminal of PRKCZ

Purification: Affinity purified

Immunogen: PRKCZ antibody was raised using the N terminal of PRKCZ corresponding to a region with amino acids MDSVMPSQEPPVDDKNEDADLPSEETDGIAYISSSRKHDSIKDDSEDLKP

Application Details

Application Notes: WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PRKCZ Blocking Peptide, catalog no. 33R-5876, is also available for use as a blocking control in assays to test for specificity of this PRKCZ antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PRKCZ antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PKC zeta

Target: PKC zeta (PRKCZ) (Protein Kinase C, zeta (PRKCZ))

Alternative Name: PRKCZ (PRKCZ Products)

Synonyms: TPKC antibody, PKCzeta antibody, prkcz-A antibody, pkc-zeta antibody, PRKCZ antibody, pkc2 antibody, PKC-ZETA antibody, PKC2 antibody, AI098070 antibody, C80388 antibody, Pkcz antibody, R74924 antibody, aPKCzeta antibody, zetaPKC antibody, 14-3-3-zetaisoform antibody, r14-3-3 antibody, pkcz antibody, si:ch211-150o23.4 antibody, protein kinase C zeta L homeolog antibody, protein kinase C zeta antibody, protein kinase C, zeta antibody, prkcz.L antibody, PRKCZ antibody, prkcz antibody, Prkcz antibody

Background: Protein kinase C (PKC) zeta is a member of the PKC family of serine/threonine kinases which are involved in a variety of cellular processes such as proliferation, differentiation and secretion. Unlike the classical PKC isoenzymes which are calcium-dependent, PKC zeta exhibits a kinase activity which is independent of calcium and diacylglycerol but not of phosphatidylserine.

Molecular Weight: 45 kDa (MW of target protein)

Pathways: NF-kappaB Signaling, RTK Signaling, Myometrial Relaxation and Contraction, Regulation of Leukocyte Mediated Immunity, Positive Regulation of Immune Effector Process, Synaptic Membrane, Production of Molecular Mediator of Immune Response, CXCR4-mediated Signaling Events, Thromboxane A2 Receptor Signaling