TJP2 antibody

Catalog No. ABIN631228

Product Details anti-TJP2 Antibody

Target: TJP2 (Tight Junction Protein 2 (Zona Occludens 2) (TJP2))

Reactivity: Human, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TJP2 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: TJP2 antibody was raised using a synthetic peptide corresponding to a region with amino acids TVVPETNKEPRYQEDPPAPQPKAAPRTFLRPSPEDEAIYGPNTKMVRFKK

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

TJP2 Blocking Peptide, catalog no. 33R-9376, is also available for use as a blocking control in assays to test for specificity of this TJP2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TJP2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for TJP2

Target: TJP2 (Tight Junction Protein 2 (Zona Occludens 2) (TJP2))

Alternative Name: TJP2 (TJP2 Products)

Synonyms: C9DUPq21.11 antibody, DFNA51 antibody, DUP9q21.11 antibody, X104 antibody, ZO2 antibody, ZO-2 antibody, zo2 antibody, tjp2 antibody, x104 antibody, zo-2 antibody, wu:fb62b09 antibody, zgc:92094 antibody, tight junction protein 2 antibody, tight junction protein 2 L homeolog antibody, tight junction protein 2b (zona occludens 2) antibody, TJP2 antibody, Tjp2 antibody, tjp2.L antibody, tjp2b antibody

Background: Tight junction proteins (TJPs) belong to a family of membrane-associated guanylate kinase (MAGUK) homologs that are involved in the organization of epithelial and endothelial intercellular junctions. TJPs bind to the cytoplasmic C termini of junctional transmembrane proteins and link them to the actin cytoskeleton.

Molecular Weight: 134 kDa (MW of target protein)