PTP4A3 antibody (Middle Region)

Catalog No. ABIN631230

Product Details anti-PTP4A3 Antibody

Target: PTP4A3 (Protein Tyrosine Phosphatase Type IVA, Member 3 (PTP4A3))

Binding Specificity: Middle Region

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PTP4A3 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: PTP4 A3 antibody was raised against the middle region of PTP4 3

Purification: Affinity purified

Immunogen: PTP4 A3 antibody was raised using the middle region of PTP4 3 corresponding to a region with amino acids LGRAPVLVALALIESGMKYEDAIQFIRQKRRGAINSKQLTYLEKYRPKQR

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PTP4A3 Blocking Peptide, catalog no. 33R-4993, is also available for use as a blocking control in assays to test for specificity of this PTP4A3 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PTP0 3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PTP4A3

Target: PTP4A3 (Protein Tyrosine Phosphatase Type IVA, Member 3 (PTP4A3))

Alternative Name: PTP4A3 (PTP4A3 Products)

Synonyms: PRL-3 antibody, PRL-R antibody, PRL3 antibody, wu:fc54b05 antibody, wu:fv52d11 antibody, zgc:77109 antibody, prl-3 antibody, prl3 antibody, ptpcaax3 antibody, PTP4A3 antibody, AV088979 antibody, Prl-3 antibody, pPtp4a3 antibody, protein tyrosine phosphatase type IVA, member 3 antibody, protein tyrosine phosphatase type IVA, member 3 L homeolog antibody, protein tyrosine phosphatase 4a3 antibody, PTP4A3 antibody, ptp4a3 antibody, ptp4a3.L antibody, Ptp4a3 antibody

Background: PTP4A3 belongs to a small class of prenylated protein tyrosine phosphatases (PTPs). PTPs are cell signaling molecules that play regulatory roles in a variety of cellular processes. This class of PTPs contains a PTP domain and a characteristic C-terminal prenylation motif. Studies of this class of PTPs in mice demonstrated that they were prenylated proteins in vivo, which suggested their association with cell plasma membrane. Overexpression of this gene in mammalian cells was reported to inhibit angiotensin-II induced cell calcium mobilization and promote cell growth.

Molecular Weight: 19 kDa (MW of target protein)