MPP2 antibody

Catalog No. ABIN631237

Product Details anti-MPP2 Antibody

Target: MPP2 (Membrane Protein, Palmitoylated 2 (MAGUK P55 Subfamily Member 2) (MPP2))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This MPP2 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: MPP2 antibody was raised using a synthetic peptide corresponding to a region with amino acids QGVGRRSLKNKLIMWDPDRYGTTVPYTSRRPKDSEREGQGYSFVSRGEME

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

MPP2 Blocking Peptide, catalog no. 33R-7575, is also available for use as a blocking control in assays to test for specificity of this MPP2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MPP2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for MPP2

Target: MPP2 (Membrane Protein, Palmitoylated 2 (MAGUK P55 Subfamily Member 2) (MPP2))

Alternative Name: MPP2 (MPP2 Products)

Synonyms: D11Bwg0652e antibody, Dlg2 antibody, Dlgh2 antibody, Pals4 antibody, DLG2 antibody, zgc:171280 antibody, mpp2 antibody, zgc:92011 antibody, membrane protein, palmitoylated 2 (MAGUK p55 subfamily member 2) antibody, membrane palmitoylated protein 2 antibody, membrane protein, palmitoylated 2a (MAGUK p55 subfamily member 2) antibody, membrane protein, palmitoylated 2 S homeolog antibody, membrane protein, palmitoylated 2b (MAGUK p55 subfamily member 2) antibody, Mpp2 antibody, MPP2 antibody, mpp2a antibody, mpp2.S antibody, mpp2b antibody

Background: Palmitoylated membrane protein 2 is a member of a family of membrane-associated proteins termed MAGUKs (membrane-associated guanylate kinase homologs).

Molecular Weight: 61 kDa (MW of target protein)