LANCL2 antibody

Catalog No. ABIN631238

Product Details anti-LANCL2 Antibody

Target: LANCL2 (LanC like 2 (LANCL2))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This LANCL2 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: LANCL2 antibody was raised using a synthetic peptide corresponding to a region with amino acids EMVKPSIDYVRHKKFRSGNYPSSLSNETDRLVHWCHGAPGVIHMLMQAYK

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

LANCL2 Blocking Peptide, catalog no. 33R-2598, is also available for use as a blocking control in assays to test for specificity of this LANCL2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LANCL2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for LANCL2

Target: LANCL2 (LanC like 2 (LANCL2))

Alternative Name: LANCL2 (LANCL2 Products)

Synonyms: 1700003F10Rik antibody, GPR69B antibody, TASP antibody, LanC (bacterial lantibiotic synthetase component C)-like 2 antibody, LanC like 2 antibody, Lancl2 antibody, LANCL2 antibody

Background: LANCL2 is necessary for abscisic acid (ABA) binding on the cell membrane and activation of the ABA signaling pathway in granulocytes.

Molecular Weight: 51 kDa (MW of target protein)