Aurora Kinase C antibody (Middle Region)

Catalog No. ABIN631252

Product Details anti-Aurora Kinase C Antibody

Target: Aurora Kinase C (AURKC)

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Aurora Kinase C antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: AURKC antibody was raised against the middle region of AURKC

Purification: Affinity purified

Immunogen: AURKC antibody was raised using the middle region of AURKC corresponding to a region with amino acids TYDEKVDLWCIGVLCYELLVGYPPFESASHSETYRRILKVDVRFPLSMPL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

AURKC Blocking Peptide, catalog no. 33R-9386, is also available for use as a blocking control in assays to test for specificity of this AURKC antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of AURKC antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Aurora Kinase C

Target: Aurora Kinase C (AURKC)

Alternative Name: AURKC (AURKC Products)

Synonyms: AURKC antibody, AIE2 antibody, AIK3 antibody, ARK3 antibody, AurC antibody, SPGF5 antibody, STK13 antibody, aurora-C antibody, AIE1 antibody, ARK-3 antibody, IAK3 antibody, Stk13 antibody, aurora kinase C antibody, AURKC antibody, Aurkc antibody

Background: AURKC may play a part in organizing microtubules in relation to the function of the centrosome/spindle pole during mitosis.

Molecular Weight: 34 kDa (MW of target protein)

Pathways: Cell Division Cycle, Maintenance of Protein Location