PRKACB antibody (Middle Region)

Catalog No. ABIN631277

Product Details anti-PRKACB Antibody

Target: PRKACB (Protein Kinase, CAMP Dependent, Catalytic, beta (PRKACB))

Binding Specificity: Middle Region

Reactivity: Human, Rat, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PRKACB antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: PRKACB antibody was raised against the middle region of PRKACB

Purification: Affinity purified

Immunogen: PRKACB antibody was raised using the middle region of PRKACB corresponding to a region with amino acids NGVSDIKTHKWFATTDWIAIYQRKVEAPFIPKFRGSGDTSNFDDYEEEDI

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PRKACB Blocking Peptide, catalog no. 33R-6712, is also available for use as a blocking control in assays to test for specificity of this PRKACB antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PRKACB antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PRKACB

Target: PRKACB (Protein Kinase, CAMP Dependent, Catalytic, beta (PRKACB))

Alternative Name: PRKACB (PRKACB Products)

Synonyms: PKACB antibody, XPKAbeta antibody, kin-1 antibody, pkacb antibody, prkacba antibody, PRKACB antibody, prkacb antibody, wu:fz54b03 antibody, zgc:110804 antibody, Pkacb antibody, protein kinase cAMP-activated catalytic subunit beta antibody, protein kinase cAMP-activated catalytic subunit beta S homeolog antibody, protein kinase, cAMP-dependent, catalytic, beta antibody, protein kinase, cAMP-dependent, catalytic, beta b antibody, protein kinase, cAMP dependent, catalytic, beta antibody, PRKACB antibody, prkacb.S antibody, prkacb antibody, Prkacb antibody, prkacbb antibody

Background: CAMP is a signaling molecule important for a variety of cellular functions. cAMP exerts its effects by activating the cAMP-dependent protein kinase, which transduces the signal through phosphorylation of different target proteins.

Molecular Weight: 40 kDa (MW of target protein)

Pathways: AMPK Signaling, Hedgehog Signaling, EGFR Signaling Pathway, Neurotrophin Signaling Pathway, Thyroid Hormone Synthesis, Myometrial Relaxation and Contraction, M Phase, G-protein mediated Events, Interaction of EGFR with phospholipase C-gamma, Lipid Metabolism