PIP4K2A antibody (N-Term)
-
- Target See all PIP4K2A Antibodies
- PIP4K2A (Phosphatidylinositol-5-Phosphate 4-Kinase, Type II, alpha (PIP4K2A))
-
Binding Specificity
- N-Term
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This PIP4K2A antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- PIP4 K4 antibody was raised against the N terminal of PIP4 4
- Purification
- Affinity purified
- Immunogen
- PIP4 K4 antibody was raised using the N terminal of PIP4 4 corresponding to a region with amino acids IDDQDFQNSLTRSAPLPNDSQARSGARFHTSYDKRYIIKTITSEDVAEMH
- Top Product
- Discover our top product PIP4K2A Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
PIP4K2A Blocking Peptide, catalog no. 33R-3909, is also available for use as a blocking control in assays to test for specificity of this PIP4K2A antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PIP0 0 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PIP4K2A (Phosphatidylinositol-5-Phosphate 4-Kinase, Type II, alpha (PIP4K2A))
- Alternative Name
- PIP4K2A (PIP4K2A Products)
- Synonyms
- PI5P4KA antibody, PIP5K2A antibody, PIP5KII-alpha antibody, PIP5KIIA antibody, PIPK antibody, AW742916 antibody, Pip5k2a antibody, pipk antibody, pi5p4ka antibody, pip5k2a antibody, pip5kiia antibody, pip4k2a antibody, zgc:194746 antibody, zgc:194777 antibody, phosphatidylinositol-5-phosphate 4-kinase type 2 alpha antibody, phosphatidylinositol-5-phosphate 4-kinase, type II, alpha antibody, phosphatidylinositol-5-phosphate 4-kinase, type II, alpha S homeolog antibody, phosphatidylinositol-5-phosphate 4-kinase, type II, alpha a antibody, PIP4K2A antibody, Pip4k2a antibody, pip4k2a.S antibody, pip4k2a antibody, pip4k2aa antibody
- Background
- Phosphatidylinositol-5,4-bisphosphate, the precursor to second messengers of the phosphoinositide signal transduction pathways, is thought to be involved in the regulation of secretion, cell proliferation, differentiation, and motility.
- Molecular Weight
- 46 kDa (MW of target protein)
- Pathways
- Inositol Metabolic Process
-