PIP4K2A antibody (N-Term)

Catalog No. ABIN631281

Product Details anti-PIP4K2A Antibody

Target: PIP4K2A (Phosphatidylinositol-5-Phosphate 4-Kinase, Type II, alpha (PIP4K2A))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PIP4K2A antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: PIP4 K4 antibody was raised against the N terminal of PIP4 4

Purification: Affinity purified

Immunogen: PIP4 K4 antibody was raised using the N terminal of PIP4 4 corresponding to a region with amino acids IDDQDFQNSLTRSAPLPNDSQARSGARFHTSYDKRYIIKTITSEDVAEMH

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PIP4K2A Blocking Peptide, catalog no. 33R-3909, is also available for use as a blocking control in assays to test for specificity of this PIP4K2A antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PIP0 0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PIP4K2A

Target: PIP4K2A (Phosphatidylinositol-5-Phosphate 4-Kinase, Type II, alpha (PIP4K2A))

Alternative Name: PIP4K2A (PIP4K2A Products)

Synonyms: PI5P4KA antibody, PIP5K2A antibody, PIP5KII-alpha antibody, PIP5KIIA antibody, PIPK antibody, AW742916 antibody, Pip5k2a antibody, pipk antibody, pi5p4ka antibody, pip5k2a antibody, pip5kiia antibody, pip4k2a antibody, zgc:194746 antibody, zgc:194777 antibody, phosphatidylinositol-5-phosphate 4-kinase type 2 alpha antibody, phosphatidylinositol-5-phosphate 4-kinase, type II, alpha antibody, phosphatidylinositol-5-phosphate 4-kinase, type II, alpha S homeolog antibody, phosphatidylinositol-5-phosphate 4-kinase, type II, alpha a antibody, PIP4K2A antibody, Pip4k2a antibody, pip4k2a.S antibody, pip4k2a antibody, pip4k2aa antibody

Background: Phosphatidylinositol-5,4-bisphosphate, the precursor to second messengers of the phosphoinositide signal transduction pathways, is thought to be involved in the regulation of secretion, cell proliferation, differentiation, and motility.

Molecular Weight: 46 kDa (MW of target protein)

Pathways: Inositol Metabolic Process