TYMS antibody (C-Term)
-
- Target See all TYMS Antibodies
- TYMS (Thymidylate Synthetase (TYMS))
-
Binding Specificity
- C-Term
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This TYMS antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- TYMS antibody was raised against the C terminal of TYMS
- Purification
- Affinity purified
- Immunogen
- TYMS antibody was raised using the C terminal of TYMS corresponding to a region with amino acids HIEPLKIQLQREPRPFPKLRILRKVEKIDDFKAEDFQIEGYNPHPTIKME
- Top Product
- Discover our top product TYMS Primary Antibody
-
-
- Application Notes
-
WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
TYMS Blocking Peptide, catalog no. 33R-3753, is also available for use as a blocking control in assays to test for specificity of this TYMS antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TYMS antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- TYMS (Thymidylate Synthetase (TYMS))
- Alternative Name
- TYMS (TYMS Products)
- Synonyms
- FN1 antibody, ECK2823 antibody, JW2795 antibody, ts antibody, Ts antibody, HST422 antibody, TMS antibody, TS antibody, thymidylate synthetase antibody, contains intron in T4 phage antibody, ThyE antibody, thymidylate synthase antibody, thymidylate synthetase L homeolog antibody, TYMS antibody, thyA antibody, td antibody, thyE antibody, DDA3937_RS04960 antibody, tyms.L antibody, XBJ1_RS15770 antibody, EAMY_RS20680 antibody, Tyms antibody
- Target Type
- Viral Protein
- Background
- TYMS catalyzes the methylation of deoxyuridylate to deoxythymidylate using 5,10-methylenetetrahydrofolate (methylene-THF) as a cofactor. This function maintains the dTMP (thymidine-5-prime monophosphate) pool critical for DNA replication and repair. The enzyme has been of interest as a target for cancer chemotherapeutic agents. It is considered to be the primary site of action for 5-fluorouracil, 5-fluoro-2-prime-deoxyuridine, and some folate analogs.
- Molecular Weight
- 36 kDa (MW of target protein)
- Pathways
- Mitotic G1-G1/S Phases
-