TYMS antibody (C-Term)

Catalog No. ABIN631290

Product Details anti-TYMS Antibody

Target: TYMS (Thymidylate Synthetase (TYMS))

Binding Specificity: C-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TYMS antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: TYMS antibody was raised against the C terminal of TYMS

Purification: Affinity purified

Immunogen: TYMS antibody was raised using the C terminal of TYMS corresponding to a region with amino acids HIEPLKIQLQREPRPFPKLRILRKVEKIDDFKAEDFQIEGYNPHPTIKME

Application Details

Application Notes: WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

TYMS Blocking Peptide, catalog no. 33R-3753, is also available for use as a blocking control in assays to test for specificity of this TYMS antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TYMS antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for TYMS

Target: TYMS (Thymidylate Synthetase (TYMS))

Alternative Name: TYMS (TYMS Products)

Synonyms: FN1 antibody, ECK2823 antibody, JW2795 antibody, ts antibody, Ts antibody, HST422 antibody, TMS antibody, TS antibody, thymidylate synthetase antibody, contains intron in T4 phage antibody, ThyE antibody, thymidylate synthase antibody, thymidylate synthetase L homeolog antibody, TYMS antibody, thyA antibody, td antibody, thyE antibody, DDA3937_RS04960 antibody, tyms.L antibody, XBJ1_RS15770 antibody, EAMY_RS20680 antibody, Tyms antibody

Target Type: Viral Protein

Background: TYMS catalyzes the methylation of deoxyuridylate to deoxythymidylate using 5,10-methylenetetrahydrofolate (methylene-THF) as a cofactor. This function maintains the dTMP (thymidine-5-prime monophosphate) pool critical for DNA replication and repair. The enzyme has been of interest as a target for cancer chemotherapeutic agents. It is considered to be the primary site of action for 5-fluorouracil, 5-fluoro-2-prime-deoxyuridine, and some folate analogs.

Molecular Weight: 36 kDa (MW of target protein)

Pathways: Mitotic G1-G1/S Phases