AHCY antibody (N-Term)

Catalog No. ABIN631294

Product Details anti-AHCY Antibody

Target: AHCY (Adenosylhomocysteinase (AHCY))

Binding Specificity: N-Term

Reactivity: Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This AHCY antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: AHCY antibody was raised against the N terminal of AHCY

Purification: Affinity purified

Immunogen: AHCY antibody was raised using the N terminal of AHCY corresponding to a region with amino acids SDKLPYKVADIGLAAWGRKALDIAENEMPGLMRMRERYSASKPLKGARIA

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

AHCY Blocking Peptide, catalog no. 33R-8359, is also available for use as a blocking control in assays to test for specificity of this AHCY antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of AHCY antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for AHCY

Target: AHCY (Adenosylhomocysteinase (AHCY))

Alternative Name: AHCY (AHCY Products)

Synonyms: sahh antibody, PSPTO5068 antibody, Ahcy antibody, SAHH antibody, adoHcyase antibody, ahcy antibody, AA987153 antibody, AL024110 antibody, CuBP antibody, D150 antibody, cb1079 antibody, hm:zeh1173 antibody, hm:zeh1364 antibody, wu:fj67b02 antibody, adenosylhomocysteinase antibody, Adenosylhomocysteinase antibody, S-adenosylhomocysteine hydrolase antibody, adenosylhomocysteinase S homeolog antibody, AHCY antibody, ahcy antibody, ahcY antibody, MMAH_RS02605 antibody, Srot_2217 antibody, Ndas_3755 antibody, Deba_0936 antibody, Palpr_2392 antibody, Calni_0569 antibody, LOC100282150 antibody, Intca_2510 antibody, Marky_0392 antibody, Desac_1394 antibody, Tc00.1047053511229.50 antibody, Tc00.1047053511589.200 antibody, Tb11.01.1350 antibody, LMJF_36_3910 antibody, MCYG_06244 antibody, Ahcy antibody, ahcy.S antibody

Background: S-adenosylhomocysteine hydrolase catalyzes the reversible hydrolysis of S-adenosylhomocysteine (AdoHcy) to adenosine (Ado) and L-homocysteine (Hcy). Thus, it regulates the intracellular S-adenosylhomocysteine (SAH) concentration thought to be important for transmethylation reactions. Deficiency in this protein is one of the different causes of hypermethioninemia.

Molecular Weight: 48 kDa (MW of target protein)