TRIM36 antibody (Middle Region)

Catalog No. ABIN631325

Product Details anti-TRIM36 Antibody

Target: TRIM36 (Tripartite Motif Containing 36 (TRIM36))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TRIM36 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: TRIM36 antibody was raised against the middle region of TRIM36

Purification: Affinity purified

Immunogen: TRIM36 antibody was raised using the middle region of TRIM36 corresponding to a region with amino acids GYIMELIAKGKASAMGLQQTHEHSRLTSKGGEARCPFEISEVGKQSLPRR

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

TRIM36 Blocking Peptide, catalog no. 33R-3678, is also available for use as a blocking control in assays to test for specificity of this TRIM36 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TRIM36 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for TRIM36

Target: TRIM36 (Tripartite Motif Containing 36 (TRIM36))

Alternative Name: TRIM36 (TRIM36 Products)

Synonyms: wu:fj48f01 antibody, zgc:153447 antibody, zgc:63476 antibody, Haprin antibody, MGC81170 antibody, TRIM36 antibody, HAPRIN antibody, RBCC728 antibody, RNF98 antibody, D18Wsu100e antibody, haprin antibody, tripartite motif containing 36 antibody, tripartite motif containing 36 L homeolog antibody, tripartite motif-containing 36 antibody, trim36 antibody, trim36.L antibody, TRIM36 antibody, Trim36 antibody

Background: The protein encoded by this gene is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region.

Molecular Weight: 7 kDa (MW of target protein)