UBE4A antibody
-
- Target See all UBE4A Antibodies
- UBE4A (Ubiquitination Factor E4A (UBE4A))
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This UBE4A antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- UBE4 A antibody was raised using a synthetic peptide corresponding to a region with amino acids QYAPQLAEALIKVFVDIEFTGDPHQFEQKFNYRRPMYPILRYMWGTDTYR
- Top Product
- Discover our top product UBE4A Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
UBE4A Blocking Peptide, catalog no. 33R-7789, is also available for use as a blocking control in assays to test for specificity of this UBE4A antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of UBE0 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- UBE4A (Ubiquitination Factor E4A (UBE4A))
- Alternative Name
- UBE4A (UBE4A Products)
- Synonyms
- 4732444G18Rik antibody, 9930123J21Rik antibody, UFD2b antibody, ufd2 antibody, ubox2 antibody, E4 antibody, UBOX2 antibody, UFD2 antibody, Ab2-232 antibody, ubiquitination factor E4A S homeolog antibody, ubiquitination factor E4A antibody, ubiquitination factor E4A (UFD2 homolog, yeast) antibody, ubiquitin conjugation factor E4 A antibody, putative ubiquitination factor E4a antibody, ube4a.S antibody, Ube4a antibody, UBE4A antibody, ube4a antibody, LOC5563714 antibody, Smp_030780 antibody
- Background
- The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. UBE4A is an additional conjugation factor, E4, which is involved in multiubiquitin chain assembly.
- Molecular Weight
- 123 kDa (MW of target protein)
-