TRIM60 antibody (N-Term)

Catalog No. ABIN631391

Product Details anti-TRIM60 Antibody

Target: TRIM60 (Tripartite Motif Containing 60 (TRIM60))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TRIM60 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: TRIM60 antibody was raised against the N terminal of TRIM60

Purification: Affinity purified

Immunogen: TRIM60 antibody was raised using the N terminal of TRIM60 corresponding to a region with amino acids LEGSLEPLRNNIERVEKVIILQGSKSVELKKKVEYKREEINSEFEQIRLF

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

TRIM60 Blocking Peptide, catalog no. 33R-4900, is also available for use as a blocking control in assays to test for specificity of this TRIM60 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TRIM60 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for TRIM60

Target: TRIM60 (Tripartite Motif Containing 60 (TRIM60))

Alternative Name: TRIM60 (TRIM60 Products)

Synonyms: RNF129 antibody, RNF33 antibody, 2czf45 antibody, Rnf33 antibody, tripartite motif containing 60 antibody, tripartite motif-containing 60 antibody, TRIM60 antibody, Trim60 antibody

Background: TRIM60 contains a RING finger domain, a motif present in a variety of functionally distinct proteins and known to be involved in protein-protein and protein-DNA interactions.

Molecular Weight: 55 kDa (MW of target protein)