CHPF2 antibody (N-Term)

Catalog No. ABIN631398

Product Details anti-CHPF2 Antibody

Target: CHPF2 (Chondroitin Polymerizing Factor 2 (CHPF2))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CHPF2 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: CSGLCA-T antibody was raised against the N terminal Of Csglca-T

Purification: Affinity purified

Immunogen: CSGLCA-T antibody was raised using the N terminal Of Csglca-T corresponding to a region with amino acids SLLRVSWIQGEGEDPCVEAVGERGGPQNPDSRARLDQSDEDFKPRIVPYY

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

CSGLCA-T Blocking Peptide, catalog no. 33R-8608, is also available for use as a blocking control in assays to test for specificity of this CSGLCA-T antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CSGLCA-T antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for CHPF2

Target: CHPF2 (Chondroitin Polymerizing Factor 2 (CHPF2))

Alternative Name: CSGLCA-T (CHPF2 Products)

Synonyms: RGD1306404 antibody, AW060945 antibody, mKIAA1402 antibody, 2010209O12Rik antibody, CSGLCA-T antibody, CSGlcAT antibody, ChSy-3 antibody, chondroitin polymerizing factor 2 antibody, Chpf2 antibody, CHPF2 antibody, chpf2 antibody

Background: CSGlcA-T belongs to the chondroitin N-acetylgalactosaminyltransferase family. It transfers glucuronic acid (GlcUA) from UDP-GlcUA to N-acetylgalactosamine residues on the non-reducing end of the elongating chondroitin polymer. CSGlcA-T has no N-acetylgalactosaminyltransferase activity.

Molecular Weight: 18 kDa (MW of target protein)

Pathways: Glycosaminoglycan Metabolic Process