KLHL9 antibody

Catalog No. ABIN631406

Product Details anti-KLHL9 Antibody

Target: KLHL9 (Kelch-Like 9 (KLHL9))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This KLHL9 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: KLHL9 antibody was raised using a synthetic peptide corresponding to a region with amino acids SALKGHLYAVGGRSAAGELATVECYNPRMNEWSYVAKMSEPHYGHAGTVY

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

KLHL9 Blocking Peptide, catalog no. 33R-8307, is also available for use as a blocking control in assays to test for specificity of this KLHL9 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KLHL9 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for KLHL9

Target: KLHL9 (Kelch-Like 9 (KLHL9))

Alternative Name: KLHL9 (KLHL9 Products)

Synonyms: 8030469P05 antibody, C530050O22Rik antibody, ENSMUSG00000070923 antibody, mKIAA1354 antibody, RGD1304814 antibody, kelch-like 9 antibody, kelch-like family member 9 antibody, kelch like family member 9 antibody, Klhl9 antibody, KLHL9 antibody

Background: KLHL9 is the substrate-specific adapter for a CUL3-based E3 ubiquitin-protein ligase complex. Within this complex, KLHL9 controls the dynamic behavior of AURKB on mitotic chromosomes and thereby coordinates faithful mitotic progression.

Molecular Weight: 69 kDa (MW of target protein)