Involucrin antibody (N-Term)

Catalog No. ABIN631419

Product Details anti-Involucrin Antibody

Target: Involucrin (IVL)

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Involucrin antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: Involucrin antibody was raised against the N terminal of IVL

Purification: Affinity purified

Immunogen: Involucrin antibody was raised using the N terminal of IVL corresponding to a region with amino acids AENPEQQLKQEKTQRDQQLNKQLEEEKKLLDQQLDQELVKRDEQLGMKKE

Application Details

Application Notes: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Involucrin Blocking Peptide, catalog no. 33R-1140, is also available for use as a blocking control in assays to test for specificity of this Involucrin antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of IVL antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Involucrin

Target: Involucrin (IVL)

Alternative Name: Involucrin (IVL Products)

Synonyms: INV antibody, NPH2 antibody, NPHP2 antibody, 1110019C06Rik antibody, IVL antibody, Nphp2 antibody, inv antibody, involucrin antibody, inversin antibody, IVL antibody, INVS antibody, Ivl antibody, Invs antibody

Background: Involucrin, a component of the keratinocyte crosslinked envelope, is found in the cytoplasm and crosslinked to membrane proteins by transglutaminase.Involucrin, a component of the keratinocyte crosslinked envelope, is found in the cytoplasm and crosslinked to membrane proteins by transglutaminase. This gene is mapped to 1q21, among calpactin I light chain, trichohyalin, profillaggrin, loricrin, and calcyclin.

Molecular Weight: 68 kDa (MW of target protein)