Erythrocyte Ankyrin antibody (Middle Region)
-
- Target See all Erythrocyte Ankyrin (ANK1) Antibodies
- Erythrocyte Ankyrin (ANK1) (Ankyrin 1, Erythrocytic (ANK1))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This Erythrocyte Ankyrin antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- Ankyrin 1 antibody was raised against the middle region of ANK1
- Purification
- Affinity purified
- Immunogen
- Ankyrin 1 antibody was raised using the middle region of ANK1 corresponding to a region with amino acids PCAMPETVVIRSEEQEQASKEYDEDSLIPSSPATETSDNISPVASPVHTG
- Top Product
- Discover our top product ANK1 Primary Antibody
-
anti-Ankyrin 1, Erythrocytic (ANK1) (AA 1-1881) antibody
ANK1 Reactivity: Human WB, IHC, ICC, IF Host: Mouse Monoclonal S388A-10 unconjugated
anti-Ankyrin 1, Erythrocytic (ANK1) (C-Term) antibodyANK1 Reactivity: Human, Mouse, Rat, Dog, Horse, Rabbit, Cow, Guinea Pig, Monkey, Bat, Pig WB, IHC, IHC (p) Host: Rabbit Polyclonal unconjugated
anti-Ankyrin 1, Erythrocytic (ANK1) (AA 1-1881) antibody (HRP)ANK1 Reactivity: Human WB, IHC, ICC, IF Host: Mouse Monoclonal S388A-10 HRP
anti-Ankyrin 1, Erythrocytic (ANK1) (AA 1-1881) antibody (FITC)ANK1 Reactivity: Human WB, IHC, ICC, IF Host: Mouse Monoclonal S388A-10 FITC
anti-Ankyrin 1, Erythrocytic (ANK1) (AA 1-1881) antibody (Biotin)ANK1 Reactivity: Human WB, IHC, ICC, IF Host: Mouse Monoclonal S388A-10 Biotin
anti-Ankyrin 1, Erythrocytic (ANK1) (AA 1-1881) antibody (PE)ANK1 Reactivity: Human WB, IHC, ICC, IF Host: Mouse Monoclonal S388A-10 PE
anti-Ankyrin 1, Erythrocytic (ANK1) (AA 1-1881) antibody (APC)ANK1 Reactivity: Human WB, IHC, ICC, IF Host: Mouse Monoclonal S388A-10 APC
anti-Ankyrin 1, Erythrocytic (ANK1) (AA 1-1881) antibody (PerCP)ANK1 Reactivity: Human WB, IHC, ICC, IF Host: Mouse Monoclonal S388A-10 PerCP
anti-Ankyrin 1, Erythrocytic (ANK1) (AA 1-1881) antibody (Atto 488)ANK1 Reactivity: Human WB, IHC, ICC, IF Host: Mouse Monoclonal S388A-10 Atto 488
anti-Ankyrin 1, Erythrocytic (ANK1) (AA 1-1881) antibody (Atto 594)ANK1 Reactivity: Human WB, IHC, ICC, IF Host: Mouse Monoclonal S388A-10 Atto 594
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
Ankyrin 1 Blocking Peptide, catalog no. 33R-6993, is also available for use as a blocking control in assays to test for specificity of this Ankyrin 1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ANK1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Erythrocyte Ankyrin (ANK1) (Ankyrin 1, Erythrocytic (ANK1))
- Alternative Name
- Ankyrin 1 (ANK1 Products)
- Synonyms
- CHANK1 antibody, wu:fa09h06 antibody, zgc:101835 antibody, ank antibody, sph1 antibody, sph2 antibody, ANK1 antibody, ANK antibody, SPH1 antibody, SPH2 antibody, Ank-1 antibody, nb antibody, pale antibody, ankyrin 1 antibody, ankyrin 1, erythrocytic a antibody, ankyrin 1 L homeolog antibody, ankyrin 1, erythrocytic antibody, ankyrin 1, erythroid antibody, ANK1 antibody, ank1a antibody, ank1 antibody, ank1.L antibody, Ank1 antibody
- Background
- Ankyrins are a family of proteins that are believed to link the integral membrane proteins to the underlying spectrin-actin cytoskeleton and play key roles in activities such as cell motility, activation and proliferation.
- Molecular Weight
- 189 kDa (MW of target protein)
- Pathways
- Synaptic Membrane
-
