TTC8 antibody (N-Term)

Catalog No. ABIN631427

Product Details anti-TTC8 Antibody

Target: TTC8 (Tetratricopeptide Repeat Domain 8 (TTC8))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TTC8 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: TTC8 antibody was raised against the N terminal of TTC8

Purification: Affinity purified

Immunogen: TTC8 antibody was raised using the N terminal of TTC8 corresponding to a region with amino acids ENAIAQVPRPGTSLKLPGTNQTGGPSQAVRPITQAGRPITGFLRPSTQSG

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

TTC8 Blocking Peptide, catalog no. 33R-2599, is also available for use as a blocking control in assays to test for specificity of this TTC8 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TTC8 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for TTC8

Target: TTC8 (Tetratricopeptide Repeat Domain 8 (TTC8))

Alternative Name: TTC8 (TTC8 Products)

Synonyms: TTC8 antibody, bbs8 antibody, fk26c02 antibody, wu:fk26c02 antibody, zgc:136718 antibody, DKFZp459L2429 antibody, BBS8 antibody, RP51 antibody, 0610012F22Rik antibody, AV001447 antibody, tetratricopeptide repeat domain 8 antibody, TTC8 antibody, ttc8 antibody, lpa_01174 antibody, Ttc8 antibody

Background: The BBSome complex is required for ciliogenesis but is dispensable for centriolar satellite function. This ciliogenic function is mediated in part by the Rab8 GDP/GTP exchange factor, which localizes to the basal body and contacts the BBSome. Rab8(GTP) enters the primary cilium and promotes extension of the ciliary membrane. Firstly the BBSome associates with the ciliary membrane and binds to Rabin8, the guanosyl exchange factor (GEF) for Rab8 and then the Rab8-GTP localizes to the cilium and promotes docking and fusion of carrier vesicles to the base of the ciliary membrane.

Molecular Weight: 54 kDa (MW of target protein)

Pathways: Hedgehog Signaling