EXOC3 antibody (Middle Region)

Catalog No. ABIN631429

Product Details anti-EXOC3 Antibody

Target: EXOC3 (Exocyst Complex Component 3 (EXOC3))

Binding Specificity: Middle Region

Reactivity: Human, Rat, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This EXOC3 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: EXOC3 antibody was raised against the middle region of EXOC3

Purification: Affinity purified

Immunogen: EXOC3 antibody was raised using the middle region of EXOC3 corresponding to a region with amino acids LERTVTTRIEGTQADTRESDKMWLVRHLEIIRKYVLDDLIVAKNLMVQCF

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

EXOC3 Blocking Peptide, catalog no. 33R-4927, is also available for use as a blocking control in assays to test for specificity of this EXOC3 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EXOC3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for EXOC3

Target: EXOC3 (Exocyst Complex Component 3 (EXOC3))

Alternative Name: EXOC3 (EXOC3 Products)

Synonyms: CG5341 antibody, Dmel\\CG5341 antibody, Dsec6 antibody, Sec6 antibody, Sec6p antibody, dsec6 antibody, sec 6 antibody, F14O23.20 antibody, F14O23_20 antibody, sec6l1 antibody, fi26g09 antibody, wu:fi26g09 antibody, wu:fi34a09 antibody, wu:fj62h05 antibody, wu:fk66f08 antibody, zgc:55709 antibody, SEC6L1 antibody, SEC6 antibody, 2810050O03Rik antibody, E430013E20Rik antibody, Sec6l1 antibody, rSec6 antibody, Secretory 6 antibody, SEC6 antibody, exocyst complex component 3 antibody, Exocyst complex component 3 antibody, Sec6 antibody, SEC6 antibody, EXOC3 antibody, exoc3 antibody, Exoc3 antibody, sec-6 antibody

Background: EXOC3 is a component of the exocyst complex, a multiple protein complex essential for targeting exocytic vesicles to specific docking sites on the plasma membrane. Though best characterized in yeast, the component proteins and functions of exocyst complex have been demonstrated to be highly conserved in higher eukaryotes. At least eight components of the exocyst complex, including this protein, are found to interact with the actin cytoskeletal remodeling and vesicle transport machinery.

Molecular Weight: 85 kDa (MW of target protein)

Pathways: Peptide Hormone Metabolism, Synaptic Vesicle Exocytosis