SCGN antibody (Middle Region)

Catalog No. ABIN631460

Product Details anti-SCGN Antibody

Target: SCGN (Secretagogin, EF-Hand Calcium Binding Protein (SCGN))

Binding Specificity: Middle Region

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SCGN antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: SCGN antibody was raised against the middle region of SCGN

Purification: Affinity purified

Immunogen: SCGN antibody was raised using the middle region of SCGN corresponding to a region with amino acids KDMMELVQPSISGVDLDKFREILLRHCDVNKDGKIQKSELALCLGLKINP

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SCGN Blocking Peptide, catalog no. 33R-4296, is also available for use as a blocking control in assays to test for specificity of this SCGN antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SCGN antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SCGN

Target: SCGN (Secretagogin, EF-Hand Calcium Binding Protein (SCGN))

Alternative Name: SCGN (SCGN Products)

Synonyms: SCGN antibody, MGC146683 antibody, CALBL antibody, DJ501N12.8 antibody, SECRET antibody, SEGN antibody, setagin antibody, zgc:100843 antibody, secretagogin, EF-hand calcium binding protein antibody, Secretagogin antibody, secretagogin, EF-hand calcium binding protein L homeolog antibody, SCGN antibody, scgn antibody, segn antibody, scgn.L antibody, Scgn antibody

Background: SCGN is a secreted calcium-binding protein which is found in the cytoplasm. It is related to calbindin D-28K and calretinin. This protein is thought to be involved in KCL-stimulated calcium flux and cell proliferation.

Molecular Weight: 32 kDa (MW of target protein)