Calretinin antibody (N-Term)

Catalog No. ABIN631478

Product Details anti-Calretinin Antibody

Target: Calretinin (CALB2) (Calbindin 2 (CALB2))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Calretinin antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: Calbindin 2 antibody was raised against the N terminal of CALB2

Purification: Affinity purified

Immunogen: Calbindin 2 antibody was raised using the N terminal of CALB2 corresponding to a region with amino acids IIGEEDLPSEEVDQELIEDSQWEEILKQPCPSQYSAIKEEDLVVWVDPLD

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Calbindin 2 Blocking Peptide, catalog no. 33R-3997, is also available for use as a blocking control in assays to test for specificity of this Calbindin 2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CALB2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Calretinin

Target: Calretinin (CALB2) (Calbindin 2 (CALB2))

Alternative Name: Calbindin 2 (CALB2 Products)

Synonyms: CAB29 antibody, CAL2 antibody, CR antibody, calb2l antibody, wu:fq18e08 antibody, zgc:73115 antibody, calb2 antibody, wu:fq17g09 antibody, zgc:73099 antibody, calbindin 2 antibody, calbindin 2a antibody, calbindin 2b antibody, CALB2 antibody, Calb2 antibody, calb2a antibody, calb2b antibody

Background: CALB2 is an intracellular calcium-binding protein belonging to the troponin C superfamily. Members of this protein family have six EF-hand domains which bind calcium. This gene encodes an intracellular calcium-binding protein belonging to the troponin C superfamily. Members of this protein family have six EF-hand domains which bind calcium. Three alternatively spliced transcript variants that encode different proteins have been described.

Molecular Weight: 30 kDa (MW of target protein)