AADAT antibody (Middle Region)

Catalog No. ABIN631490

Product Details anti-AADAT Antibody

Target: AADAT (Aminoadipate Aminotransferase (AADAT))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This AADAT antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: AADAT antibody was raised against the middle region of AADAT

Purification: Affinity purified

Immunogen: AADAT antibody was raised using the middle region of AADAT corresponding to a region with amino acids EIYELARKYDFLIIEDDPYYFLQFNKFRVPTFLSMDVDGRVIRADSFSKI

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

AADAT Blocking Peptide, catalog no. 33R-2491, is also available for use as a blocking control in assays to test for specificity of this AADAT antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of AADAT antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for AADAT

Target: AADAT (Aminoadipate Aminotransferase (AADAT))

Alternative Name: AADAT (AADAT Products)

Synonyms: KAT2 antibody, KATII antibody, AI875679 antibody, Aadt antibody, Kat2 antibody, mKat-2 antibody, MGC80030 antibody, kat2 antibody, katii antibody, aminoadipate aminotransferase antibody, aminoadipate aminotransferase S homeolog antibody, AADAT antibody, Aadat antibody, aadat.S antibody, aadat antibody

Background: AADAT is a protein that is highly similar to mouse and rat kynurenine aminotransferase II. The rat protein is a homodimer with two transaminase activities.

Molecular Weight: 47 kDa (MW of target protein)