KNG1 antibody (Middle Region)

Catalog No. ABIN631493

Product Details anti-KNG1 Antibody

Target: KNG1 (Kininogen 1 (KNG1))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This KNG1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: KNG1 antibody was raised against the middle region of KNG1

Purification: Affinity purified

Immunogen: KNG1 antibody was raised using the middle region of KNG1 corresponding to a region with amino acids YPGKDFVQPPTKICVGCPRDIPTNSPELEETLTHTITKLNAENNATFYFK

Application Details

Application Notes: WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

KNG1 Blocking Peptide, catalog no. 33R-10197, is also available for use as a blocking control in assays to test for specificity of this KNG1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KNG1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for KNG1

Target: KNG1 (Kininogen 1 (KNG1))

Alternative Name: KNG1 (KNG1 Products)

Synonyms: BDK antibody, BK antibody, KNG antibody, Kng antibody, KNG2 antibody, fb64g01 antibody, wu:fb64g01 antibody, zgc:103569 antibody, kininogen antibody, bdk antibody, kng antibody, KNG1 antibody, IHRP antibody, KINKG antibody, KINKH antibody, Kng1 antibody, Kngk antibody, kininogen 1 antibody, kininogen 1 L homeolog antibody, inter-alpha-trypsin inhibitor heavy chain family member 4 antibody, kininogen 2-like 1 antibody, KNG1 antibody, Kng1 antibody, kng1 antibody, kng1.L antibody, ITIH4 antibody, Kng2l1 antibody

Background: Kininogens are inhibitors of thiol proteases. HMW-kininogen plays an important role in blood coagulation by helping to position optimally prekallikrein and factor XI next to factor XII and inhibits the thrombin- and plasmin-induced aggregation of thrombocytes. The active peptide bradykinin that is released from HMW-kininogen shows a variety of physiological effects such as influence in smooth muscle contraction, induction of hypotension, natriuresis and diuresis, etc.

Molecular Weight: 72 kDa (MW of target protein)

Pathways: ACE Inhibitor Pathway, Glycosaminoglycan Metabolic Process