SDSL antibody (N-Term)

Catalog No. ABIN631494

Product Details anti-SDSL Antibody

Target: SDSL (Serine Dehydratase-Like (SDSL))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SDSL antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: SDSL antibody was raised against the N terminal of SDSL

Purification: Affinity purified

Immunogen: SDSL antibody was raised using the N terminal of SDSL corresponding to a region with amino acids MDGPVAEHAKQEPFHVVTPLLESWALSQVAGMPVFLKCENVQPSGSFKIR

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SDSL Blocking Peptide, catalog no. 33R-5836, is also available for use as a blocking control in assays to test for specificity of this SDSL antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SDSL antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SDSL

Target: SDSL (Serine Dehydratase-Like (SDSL))

Alternative Name: SDSL (SDSL Products)

Synonyms: MGC68790 antibody, SDSL antibody, sds-rs1 antibody, MGC159817 antibody, SDH 2 antibody, SDS-RS1 antibody, TDH antibody, 4432411H13Rik antibody, AI504310 antibody, SDH1 antibody, serine dehydratase like S homeolog antibody, serine dehydratase like antibody, serine dehydratase antibody, serine dehydratase-like antibody, sdsl.S antibody, SDSL antibody, sdsl antibody, SDS antibody, LOC100367535 antibody, LOC100539678 antibody, LOC100634528 antibody, Sdsl antibody

Background: SDSL has low serine dehydratase and threonine dehydratase activity.

Molecular Weight: 35 kDa (MW of target protein)