PAOX antibody

Catalog No. ABIN631500

Product Details anti-PAOX Antibody

Target: PAOX (Polyamine Oxidase (Exo-N4-Amino) (PAOX))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PAOX antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: PAOX antibody was raised using a synthetic peptide corresponding to a region with amino acids LCLTQVLRRVTGNPRLPAPKSVLRSRWHSAPYTRGSYSYVAVGSTGGDLD

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PAOX Blocking Peptide, catalog no. 33R-4825, is also available for use as a blocking control in assays to test for specificity of this PAOX antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PAOX antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PAOX

Target: PAOX (Polyamine Oxidase (Exo-N4-Amino) (PAOX))

Alternative Name: PAOX (PAOX Products)

Synonyms: PAO antibody, mpao1 antibody, 2410012F02Rik antibody, AI118225 antibody, Pao antibody, pao antibody, polyamine oxidase antibody, polyamine oxidase 1 antibody, amine oxidase family protein antibody, si:dkey-275b16.2 antibody, polyamine oxidase (exo-N4-amino) antibody, polyamine oxidase (exo-N4-amino) L homeolog antibody, PAOX antibody, pao1 antibody, NFIA_077590 antibody, POPTR_0011s12590g antibody, si:dkey-275b16.2 antibody, Paox antibody, paox.L antibody

Background: PAOX belongs to the flavin monoamine oxidase family. PAOX is a flavoenzyme which catalyzes the oxidation of N(1)-acetylspermine to spermidine and is thus involved in the polyamine back-conversion. It can also oxidize N(1)-acetylspermidine to putrescine. PAOX does not oxidize spermidine. It plays an important role in the regulation of polyamine intracellular concentration and has the potential to act as a determinant of cellular sensitivity to the antitumor polyamine analogs.

Molecular Weight: 25 kDa (MW of target protein)