NEXN antibody

Catalog No. ABIN631522

Product Details anti-NEXN Antibody

Target: NEXN (Nexilin (NEXN))

Reactivity: Rat, Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This NEXN antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: Nexilin antibody was raised using a synthetic peptide corresponding to a region with amino acids EELERQRQENRKKQAEEEARKRLEEEKRAFEEARRQMVNEDEENQDTAKI

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Nexilin Blocking Peptide, catalog no. 33R-2372, is also available for use as a blocking control in assays to test for specificity of this Nexilin antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NEXN antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for NEXN

Target: NEXN (Nexilin (NEXN))

Alternative Name: Nexilin (NEXN Products)

Synonyms: 1110046H09Rik antibody, AA553326 antibody, NELIN antibody, CMH20 antibody, nexilin antibody, nexilin F-actin binding protein antibody, nexilin F-actin binding protein S homeolog antibody, nexilin (F actin binding protein) antibody, LOC100422793 antibody, nexn antibody, Nexn antibody, nexn.S antibody, NEXN antibody

Background: NEXN is involved in regulating cell migration through association with the actin cytoskeleton.

Molecular Weight: 81 kDa (MW of target protein)