ACAA1 antibody

Catalog No. ABIN631524

Product Details anti-ACAA1 Antibody

Target: ACAA1 (Acetyl-CoA Acyltransferase 1 (ACAA1))

Reactivity: Human, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ACAA1 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: ACAA1 antibody was raised using a synthetic peptide corresponding to a region with amino acids ADVVVVHGRRTAICRAGRGGFKDTTPDELLSAVMTAVLKDVNLRPEQLGD

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ACAA1 Blocking Peptide, catalog no. 33R-1110, is also available for use as a blocking control in assays to test for specificity of this ACAA1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ACAA1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ACAA1

Target: ACAA1 (Acetyl-CoA Acyltransferase 1 (ACAA1))

Alternative Name: ACAA1 (ACAA1 Products)

Synonyms: ACAA antibody, PTHIO antibody, THIO antibody, Acaa antibody, Acaa1 antibody, D9Ertd25e antibody, PTL antibody, zgc:92385 antibody, acaa antibody, pthio antibody, thio antibody, A2MP antibody, Pktaa antibody, acetyl-CoA acyltransferase 1 antibody, acetyl-Coenzyme A acyltransferase 1A antibody, acetyl-CoA acyltransferase 1 L homeolog antibody, ACP synthase antibody, alpha-2-macroglobulin pseudogene 1 antibody, acetyl-CoA acyltransferase 1A antibody, ACAA1 antibody, Acaa1a antibody, acaa1.L antibody, acaa1 antibody, AF_RS00150 antibody, A2MP1 antibody, Acaa1 antibody

Background: ACAA1 is an enzyme operative in the beta-oxidation system of the peroxisomes. Deficiency of this enzyme leads to pseudo-Zellweger syndrome.

Molecular Weight: 44 kDa (MW of target protein)

Pathways: Monocarboxylic Acid Catabolic Process