NAA30 antibody (Middle Region)

Catalog No. ABIN631528

Product Details anti-NAA30 Antibody

Target: NAA30 (N(alpha)-Acetyltransferase 30, NatC Catalytic Subunit (NAA30))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This NAA30 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: NAT12 antibody was raised against the middle region of NAT12

Purification: Affinity purified

Immunogen: NAT12 antibody was raised using the middle region of NAT12 corresponding to a region with amino acids EQVRLLSSSLTADCSLRSPSGREVEPGEDRTIRYVRYESELQMPDIMRLI

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

NAT12 Blocking Peptide, catalog no. 33R-2683, is also available for use as a blocking control in assays to test for specificity of this NAT12 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NAT12 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for NAA30

Target: NAA30 (N(alpha)-Acetyltransferase 30, NatC Catalytic Subunit (NAA30))

Alternative Name: NAT12 (NAA30 Products)

Synonyms: C14orf35 antibody, MAK3 antibody, Mak3p antibody, NAT12 antibody, 4930487N19Rik antibody, 5730533P17Rik antibody, AI447922 antibody, AW322455 antibody, Nat12 antibody, RGD1559923 antibody, mak3 antibody, mak3p antibody, nat12 antibody, N(alpha)-acetyltransferase 30, NatC catalytic subunit antibody, N(alpha)-acetyltransferase 30, NatC catalytic subunit S homeolog antibody, NAA30 antibody, Naa30 antibody, naa30.S antibody

Background: NAT12 belongs to the acetyltransferase family, MAK3 subfamily. It contains 1 N-acetyltransferase domain. It is a probable N-acetyltransferase.

Molecular Weight: 39 kDa (MW of target protein)