POLR3F antibody (N-Term)

Catalog No. ABIN631535

Product Details anti-POLR3F Antibody

Target: POLR3F (Polymerase (RNA) III (DNA Directed) Polypeptide F, 39 KDa (POLR3F))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This POLR3F antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: POLR3 F antibody was raised against the N terminal of POLR3

Purification: Affinity purified

Immunogen: POLR3 F antibody was raised using the N terminal of POLR3 corresponding to a region with amino acids MAEVKVKVQPPDADPVEIENRIIELCHQFPHGITDQVIQNEMPHIEAQQR

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

POLR3F Blocking Peptide, catalog no. 33R-5647, is also available for use as a blocking control in assays to test for specificity of this POLR3F antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of POLR0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for POLR3F

Target: POLR3F (Polymerase (RNA) III (DNA Directed) Polypeptide F, 39 KDa (POLR3F))

Alternative Name: POLR3F (POLR3F Products)

Synonyms: 2810411G20Rik antibody, 3010019O03Rik antibody, 3110032A07Rik antibody, RPC39 antibody, RPC6 antibody, zgc:56299 antibody, zgc:76983 antibody, RNA polymerase III subunit F antibody, polymerase (RNA) III (DNA directed) polypeptide F antibody, POLR3F antibody, Polr3f antibody, polr3f antibody

Background: POLR3F is one of more than a dozen subunits forming eukaryotic RNA polymerase III (RNA Pol III), which transcribes 5S ribosomal RNA and tRNA genes. This protein has been shown to bind both TFIIIB90 and TBP, two subunits of RNA polymerase III transcription initiation factor IIIB (TFIIIB). Unlike most of the other RNA Pol III subunits, the encoded protein is unique to this polymerase.

Molecular Weight: 36 kDa (MW of target protein)