POLR3F antibody (N-Term)
-
- Target See all POLR3F Antibodies
- POLR3F (Polymerase (RNA) III (DNA Directed) Polypeptide F, 39 KDa (POLR3F))
-
Binding Specificity
- N-Term
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This POLR3F antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- POLR3 F antibody was raised against the N terminal of POLR3
- Purification
- Affinity purified
- Immunogen
- POLR3 F antibody was raised using the N terminal of POLR3 corresponding to a region with amino acids MAEVKVKVQPPDADPVEIENRIIELCHQFPHGITDQVIQNEMPHIEAQQR
- Top Product
- Discover our top product POLR3F Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
POLR3F Blocking Peptide, catalog no. 33R-5647, is also available for use as a blocking control in assays to test for specificity of this POLR3F antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of POLR0 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- POLR3F (Polymerase (RNA) III (DNA Directed) Polypeptide F, 39 KDa (POLR3F))
- Alternative Name
- POLR3F (POLR3F Products)
- Synonyms
- 2810411G20Rik antibody, 3010019O03Rik antibody, 3110032A07Rik antibody, RPC39 antibody, RPC6 antibody, zgc:56299 antibody, zgc:76983 antibody, RNA polymerase III subunit F antibody, polymerase (RNA) III (DNA directed) polypeptide F antibody, POLR3F antibody, Polr3f antibody, polr3f antibody
- Background
- POLR3F is one of more than a dozen subunits forming eukaryotic RNA polymerase III (RNA Pol III), which transcribes 5S ribosomal RNA and tRNA genes. This protein has been shown to bind both TFIIIB90 and TBP, two subunits of RNA polymerase III transcription initiation factor IIIB (TFIIIB). Unlike most of the other RNA Pol III subunits, the encoded protein is unique to this polymerase.
- Molecular Weight
- 36 kDa (MW of target protein)
-