PWWP2A antibody (C-Term)

Catalog No. ABIN631539

Product Details anti-PWWP2A Antibody

Target: PWWP2A (PWWP Domain Containing 2A (PWWP2A))

Binding Specificity: C-Term

Reactivity: Human, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PWWP2A antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: PWWP2 A antibody was raised against the C terminal of PWWP2

Purification: Affinity purified

Immunogen: PWWP2 A antibody was raised using the C terminal of PWWP2 corresponding to a region with amino acids PQSRCTSTRSAGLNKWQLLHQTVTSPAAPLQCLTDHCGFRLGALKLTVKR

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PWWP2A Blocking Peptide, catalog no. 33R-7313, is also available for use as a blocking control in assays to test for specificity of this PWWP2A antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PWWP0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PWWP2A

Target: PWWP2A (PWWP Domain Containing 2A (PWWP2A))

Alternative Name: PWWP2A (PWWP2A Products)

Synonyms: MST101 antibody, 4631424J17Rik antibody, AI891583 antibody, AU024105 antibody, D930040F23Rik antibody, RGD1305891 antibody, PWWP domain containing 2A antibody, PWWP2A antibody, Pwwp2a antibody

Background: PWWP2A contains 1 PWWP domain. The exact function of PWWP2A remains unknown.

Molecular Weight: 61 kDa (MW of target protein)