GPT2 antibody

Catalog No. ABIN631541

Product Details anti-GPT2 Antibody

Target: GPT2 (Glutamic Pyruvate Transaminase (Alanine Aminotransferase) 2 (GPT2))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This GPT2 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: GPT2 antibody was raised using a synthetic peptide corresponding to a region with amino acids EIKGQLVKLLSVRLCPPVSGQAAMDIVVNPPVAGEESFEQFSREKESVLG

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

GPT2 Blocking Peptide, catalog no. 33R-2475, is also available for use as a blocking control in assays to test for specificity of this GPT2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GPT2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for GPT2

Target: GPT2 (Glutamic Pyruvate Transaminase (Alanine Aminotransferase) 2 (GPT2))

Alternative Name: GPT2 (GPT2 Products)

Synonyms: ALT2 antibody, GPT2 antibody, im:7150662 antibody, sb:cb580 antibody, zgc:165657 antibody, Cc2-5 antibody, 4631422C05Rik antibody, AU014768 antibody, AU041193 antibody, C87201 antibody, ALANINE AMINOTRANSFERASE 2 antibody, AtAlaAT2 antibody, AtAlaATm antibody, T10D10.20 antibody, T10D10_20 antibody, alanine aminotransferase 2 antibody, glutamic--pyruvic transaminase 2 antibody, glutamic pyruvate transaminase (alanine aminotransferase) 2 L homeolog antibody, glutamic pyruvate transaminase (alanine aminotransferase) 2 antibody, alanine aminotransferase 2 antibody, GPT2 antibody, gpt2.L antibody, gpt2 antibody, PTRG_06494 antibody, Gpt2 antibody, ALAAT2 antibody

Background: GPT and GPT2, also known as alanine transaminases, are pyridoxal enzymes that catalyze the reversible transamination between alanine and 2-oxoglutarate to form pyruvate and glutamate. By mediating the conversion of these 4 major intermediate metabolites, these transaminases have roles in gluconeogenesis and in amino acid metabolism.GPT and GPT2, also known as alanine transaminases, are pyridoxal enzymes that catalyze the reversible transamination between alanine and 2-oxoglutarate to form pyruvate and glutamate.

Molecular Weight: 58 kDa (MW of target protein)