PWWP2B antibody (N-Term)

Catalog No. ABIN631542

Product Details anti-PWWP2B Antibody

Target: PWWP2B (PWWP Domain Containing 2B (PWWP2B))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PWWP2B antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: PWWP2 B antibody was raised against the N terminal of PWWP2

Purification: Affinity purified

Immunogen: PWWP2 B antibody was raised using the N terminal of PWWP2 corresponding to a region with amino acids ILLDCTKKSGLFGLPPLAPLPQVDESPVNDSHGRAPEEGDAEVMQLGSSS

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PWWP2B Blocking Peptide, catalog no. 33R-4054, is also available for use as a blocking control in assays to test for specificity of this PWWP2B antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PWWP0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PWWP2B

Target: PWWP2B (PWWP Domain Containing 2B (PWWP2B))

Alternative Name: PWWP2B (PWWP2B Products)

Synonyms: PWWP2 antibody, RP11-273H7.1 antibody, bA432J24.1 antibody, pp8607 antibody, Pwwp2 antibody, AI594893 antibody, D7Ertd517e antibody, D930023J19Rik antibody, PWWP2B antibody, MGC140452 antibody, PWWP domain containing 2B antibody, PWWP2B antibody, Pwwp2b antibody

Background: The function of PWWP2B protein is not widely studied, and is yet to be elucidated fully.

Molecular Weight: 53 kDa (MW of target protein)