PPIL3 antibody

Catalog No. ABIN631557

Product Details anti-PPIL3 Antibody

Target: PPIL3 (Peptidylprolyl Isomerase (Cyclophilin)-Like 3 (PPIL3))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PPIL3 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: PPIL3 antibody was raised using a synthetic peptide corresponding to a region with amino acids AGVQWRDLGSLQPPPPGFKQVFCLSLPRTGRGGNSIWGKKFEDEYSEYLK

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PPIL3 Blocking Peptide, catalog no. 33R-1233, is also available for use as a blocking control in assays to test for specificity of this PPIL3 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PPIL3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PPIL3

Target: PPIL3 (Peptidylprolyl Isomerase (Cyclophilin)-Like 3 (PPIL3))

Alternative Name: PPIL3 (PPIL3 Products)

Synonyms: MGC89451 antibody, CYPJ antibody, Cyp10l antibody, 2310076N22Rik antibody, 2510026K04Rik antibody, peptidylprolyl isomerase like 3 antibody, peptidylprolyl isomerase (cyclophilin)-like 3 antibody, ppil3 antibody, PPIL3 antibody, Ppil3 antibody

Background: This gene encodes a member of the cyclophilin family. Cyclophilins catalyze the cis-trans isomerization of peptidylprolyl imide bonds in oligopeptides. They have been proposed to act either as catalysts or as molecular chaperones in protein-folding events

Molecular Weight: 18 kDa (MW of target protein)

Pathways: SARS-CoV-2 Protein Interactome