PTGR2 antibody (Middle Region)

Catalog No. ABIN631563

Product Details anti-PTGR2 Antibody

Target: PTGR2 (Prostaglandin Reductase 2 (PTGR2))

Binding Specificity: Middle Region

Reactivity: Human, Rat, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PTGR2 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: ZADH1 antibody was raised against the middle region of Zadh1

Purification: Affinity purified

Immunogen: ZADH1 antibody was raised using the middle region of Zadh1 corresponding to a region with amino acids ILDGNSLEKVDPQLVDGHLSYFLGAIGMPGLTSLIGIQEKGHITAGSNKT

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ZADH1 Blocking Peptide, catalog no. 33R-4040, is also available for use as a blocking control in assays to test for specificity of this ZADH1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ZADH1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PTGR2

Target: PTGR2 (Prostaglandin Reductase 2 (PTGR2))

Alternative Name: ZADH1 (PTGR2 Products)

Synonyms: ZADH1 antibody, MGC146252 antibody, PGR2 antibody, 1810016I24Rik antibody, 9130222H03Rik antibody, 9630002F03Rik antibody, AI838763 antibody, B830026H24Rik antibody, PGR-2 antibody, PRG-2 antibody, Zadh1 antibody, prostaglandin reductase 2 antibody, prostaglandin reductase 2 S homeolog antibody, PTGR2 antibody, ptgr2 antibody, ptgr2.S antibody, Ptgr2 antibody

Background: ZADH1 is an enzyme involved in the metabolism of prostaglandins. ZADH1 catalyzes the NADPH-dependent conversion of 15-keto-prostaglandin E2 to 15-keto-13,14-dihydro-prostaglandin E2. ZADH1 may also be involved in regulating activation of the peroxisome proliferator-activated receptor.

Molecular Weight: 38 kDa (MW of target protein)