DPCD antibody (Middle Region)

Catalog No. ABIN631572

Product Details anti-DPCD Antibody

Target: DPCD (Deleted in Primary Ciliary Dyskinesia Homolog (DPCD))

Binding Specificity: Middle Region

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This DPCD antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: RP11-529 I10.4 antibody was raised against the middle region of RP11-529 10.4

Purification: Affinity purified

Immunogen: RP11-529 I10.4 antibody was raised using the middle region of RP11-529 10.4 corresponding to a region with amino acids APLGAGNLGPELIKESNANPIFMRKDTKMSFQWRIRNLPYPKDVYSVSVD

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

RP11-529I10.4 Blocking Peptide, catalog no. 33R-1427, is also available for use as a blocking control in assays to test for specificity of this RP11-529I10.4 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RP11-520 10.4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for DPCD

Target: DPCD (Deleted in Primary Ciliary Dyskinesia Homolog (DPCD))

Alternative Name: RP11-529I10.4 (DPCD Products)

Synonyms: RP11-529I10.4 antibody, zgc:153412 antibody, rp11-529i10.4 antibody, 5330431N19Rik antibody, Ndac antibody, RGD1307648 antibody, deleted in primary ciliary dyskinesia homolog (mouse) antibody, deleted in a mouse model of primary ciliary dyskinesia S homeolog antibody, deleted in primary ciliary dyskinesia antibody, DPCD antibody, dpcd antibody, dpcd.S antibody, Dpcd antibody

Background: RP11-529I10.4 (DPCD) belongs to the DPCD family. It may play a role in the formation or function of ciliated cells. Deletion of the DPCD gene may be a cause of primary ciliary dyskinesia (PCD).

Molecular Weight: 23 kDa (MW of target protein)