GABARAPL1 antibody

Catalog No. ABIN631573

Product Details anti-GABARAPL1 Antibody

Target: GABARAPL1 (GABA(A) Receptor-Associated Protein Like 1 (GABARAPL1))

Reactivity: Human, Rat, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This GABARAPL1 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: GABARAPL1 antibody was raised using a synthetic peptide corresponding to a region with amino acids MKFQYKEDHPFEYRKKEGEKIRKKYPDRVPVIVEKAPKARVPDLDKRKYL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

GABARAPL1 Blocking Peptide, catalog no. 33R-6137, is also available for use as a blocking control in assays to test for specificity of this GABARAPL1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GABARAPL1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for GABARAPL1

Target: GABARAPL1 (GABA(A) Receptor-Associated Protein Like 1 (GABARAPL1))

Alternative Name: GABARAPL1 (GABARAPL1 Products)

Synonyms: gabarapl1 antibody, apg8l antibody, atg8 antibody, atg8l antibody, gec1 antibody, gabarapl1-a antibody, GABARAPL3 antibody, APG8-LIKE antibody, APG8L antibody, ATG8 antibody, ATG8B antibody, ATG8L antibody, GEC1 antibody, Gec1 antibody, 3110025G09Rik antibody, 9130422N19Rik antibody, AI196471 antibody, Apg8l antibody, Atg8l antibody, GECI antibody, GEC-1 antibody, GABA(A) receptor-associated protein like 1 antibody, GABA(A) receptor-associated protein like 1 S homeolog antibody, GABA type A receptor associated protein like 1 antibody, gamma-aminobutyric acid (GABA) A receptor-associated protein-like 1 antibody, gabarapl1 antibody, gabarapl1.S antibody, GABARAPL1 antibody, Gabarapl1 antibody

Background: GABARAPL1 increases cell-surface expression of kappa-type opioid receptor through facilitating anterograde intracellular trafficking of the receptor.

Molecular Weight: 14 kDa (MW of target protein)

Pathways: Autophagy