ARPC2 antibody (N-Term)

Catalog No. ABIN631598

Product Details anti-ARPC2 Antibody

Target: ARPC2 (Actin Related Protein 2/3 Complex, Subunit 2, 34kDa (ARPC2))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ARPC2 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: ARPC2 antibody was raised against the N terminal of ARPC2

Purification: Affinity purified

Immunogen: ARPC2 antibody was raised using the N terminal of ARPC2 corresponding to a region with amino acids MVLNVYCCFFQISDIQTMKINQTILKEFILVGFSVYPHVQTFLFVVFFCL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ARPC2 Blocking Peptide, catalog no. 33R-6593, is also available for use as a blocking control in assays to test for specificity of this ARPC2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ARPC2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ARPC2

Target: ARPC2 (Actin Related Protein 2/3 Complex, Subunit 2, 34kDa (ARPC2))

Alternative Name: ARPC2 (ARPC2 Products)

Synonyms: arc34 antibody, p34-arc antibody, pnas-139 antibody, pro2446 antibody, Arpc2 antibody, Arc-p34 antibody, 2210023N03Rik antibody, 34kDa antibody, p34-Arc antibody, fk84a07 antibody, wu:fa22f07 antibody, wu:fk84a07 antibody, zgc:77769 antibody, ARC34 antibody, PNAS-139 antibody, actin related protein 2/3 complex subunit 2 antibody, actin related protein 2/3 complex, subunit 2, 34kDa antibody, actin related protein 2/3 complex, subunit 2 antibody, actin related protein 2/3 complex subunit 2 S homeolog antibody, ARPC2 antibody, arpc2 antibody, Arpc2 antibody, arpc2.S antibody

Background: ARPC2 is one of seven subunits of the human Arp2/3 protein complex. The Arp2/3 protein complex has been implicated in the control of actin polymerization in cells and has been conserved through evolution. The exact role of ARPC2, the p34 subunit, has yet to be determined.

Molecular Weight: 33 kDa (MW of target protein)

Pathways: RTK Signaling, Regulation of Actin Filament Polymerization