PCSK4 antibody (N-Term)

Catalog No. ABIN631599

Product Details anti-PCSK4 Antibody

Target: PCSK4 (Proprotein Convertase Subtilisin/kexin Type 4 (PCSK4))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PCSK4 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: PCSK4 antibody was raised against the N terminal of PCSK4

Purification: Affinity purified

Immunogen: PCSK4 antibody was raised using the N terminal of PCSK4 corresponding to a region with amino acids VSSWAVQVSQGNREVERLARKFGFVNLGPIFPDGQYFHLRHRGVVQQSLT

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PCSK4 Blocking Peptide, catalog no. 33R-9828, is also available for use as a blocking control in assays to test for specificity of this PCSK4 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PCSK4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PCSK4

Target: PCSK4 (Proprotein Convertase Subtilisin/kexin Type 4 (PCSK4))

Alternative Name: PCSK4 (PCSK4 Products)

Synonyms: PC4 antibody, SPC5 antibody, AI647044 antibody, L21221 antibody, NEC 3 antibody, NEC3 antibody, PCSK4 antibody, pc4 antibody, spc5 antibody, MGC146505 antibody, pcsk4 antibody, proprotein convertase subtilisin/kexin type 4 antibody, proprotein convertase subtilisin/kexin type 4 L homeolog antibody, PCSK4 antibody, Pcsk4 antibody, pcsk4 antibody, pcsk4.L antibody

Background: PCSK4 is involved in the processing of hormone and other protein precursors at sites comprised of pairs of basic amino acid residues. PCSK4 plays a role in transcriptional coactivation. PCSK4 may be involved in stabilizing the multiprotein transcription complex.Proprotein convertases, including PCSK4, are calcium-dependent serine proteases related to bacterial subtilisins and to yeast kexin.

Molecular Weight: 83 kDa (MW of target protein)