Nucleostemin antibody

Catalog No. ABIN631618

Product Details anti-Nucleostemin Antibody

Target: Nucleostemin (GNL3) (Guanine Nucleotide Binding Protein-Like 3 (Nucleolar) (GNL3))

Reactivity: Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Nucleostemin antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: GNL3 antibody was raised using a synthetic peptide corresponding to a region with amino acids MTCHKRYKIQKKVREHHRKLRKEAKKRGHKKPRKDPGVPNSAPFKEALLR

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

GNL3 Blocking Peptide, catalog no. 33R-6534, is also available for use as a blocking control in assays to test for specificity of this GNL3 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GNL3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Nucleostemin

Target: Nucleostemin (GNL3) (Guanine Nucleotide Binding Protein-Like 3 (Nucleolar) (GNL3))

Alternative Name: GNL3 (GNL3 Products)

Synonyms: id:ibd2914 antibody, nstm antibody, wu:fb38a04 antibody, wu:fc55d07 antibody, zgc:123093 antibody, e2ig3 antibody, C77032 antibody, E2IG3 antibody, NNP47 antibody, NS antibody, BC037996 antibody, Ns antibody, guanine nucleotide binding protein-like 3 (nucleolar) antibody, G protein nucleolar 3 antibody, guanine nucleotide binding protein-like 3 (nucleolar) L homeolog antibody, gnl3 antibody, GNL3 antibody, Gnl3 antibody, gnl3.L antibody

Background: GNL3 may be required to maintain the proliferative capacity of stem cells and may play an important role in tumorigenesis.

Molecular Weight: 60 kDa (MW of target protein)