EEF1A2 antibody (Middle Region)

Catalog No. ABIN631619

Product Details anti-EEF1A2 Antibody

Target: EEF1A2 (Eukaryotic Translation Elongation Factor 1 alpha 2 (EEF1A2))

Binding Specificity: Middle Region

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This EEF1A2 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: EEF1 A2 antibody was raised against the middle region of EEF1 2

Purification: Affinity purified

Immunogen: EEF1 A2 antibody was raised using the middle region of EEF1 2 corresponding to a region with amino acids VIDCHTAHIACKFAELKEKIDRRSGKKLEDNPKSLKSGDAAIVEMVPGKP

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

EEF1A2 Blocking Peptide, catalog no. 33R-9588, is also available for use as a blocking control in assays to test for specificity of this EEF1A2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EEF0 2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for EEF1A2

Target: EEF1A2 (Eukaryotic Translation Elongation Factor 1 alpha 2 (EEF1A2))

Alternative Name: EEF1A2 (EEF1A2 Products)

Synonyms: EEF1AL antibody, EF-1-alpha-2 antibody, EF1A antibody, HS1 antibody, STN antibody, STNL antibody, EEF1A2 antibody, Eef1a antibody, S1 antibody, wasted antibody, wst antibody, Ps10 antibody, RATPS10 antibody, Stnl antibody, eef1al antibody, ef1a antibody, stnl antibody, EEF1A-2 antibody, zgc:92085 antibody, eukaryotic translation elongation factor 1 alpha 2 antibody, eukaryotic translation elongation factor 1 alpha 1 antibody, eukaryotic translation elongation factor 1 alpha 2 S homeolog antibody, putative elongation factor 1-alpha-like 3 antibody, EEF1A2 antibody, EEF1A1 antibody, Eef1a2 antibody, eef1a2.S antibody, eef1a2 antibody, LOC739210 antibody, EEF1 antibody, eef1 antibody

Background: EEF1A2 is an isoform of the alpha subunit of the elongation factor-1 complex, which is responsible for the enzymatic delivery of aminoacyl tRNAs to the ribosome. This isoform (alpha 2) is expressed in brain, heart and skeletal muscle, and the other isoform (alpha 1) is expressed in brain, placenta, lung, liver, kidney, and pancreas. This gene may be critical in the development of ovarian cancer. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.

Molecular Weight: 50 kDa (MW of target protein)