PRAS40 antibody

Catalog No. ABIN631641

Product Details anti-PRAS40 Antibody

Target: PRAS40 (AKT1S1) (AKT1 Substrate 1 (Proline-Rich) (AKT1S1))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PRAS40 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: AKT1 S1 antibody was raised using a synthetic peptide corresponding to a region with amino acids KSLPVSVPVWGFKEKRTEARSSDEENGPPSSPDLDRIAASMRALVLREAE

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

AKT1S1 Blocking Peptide, catalog no. 33R-4654, is also available for use as a blocking control in assays to test for specificity of this AKT1S1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of AKT0 1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PRAS40

Target: PRAS40 (AKT1S1) (AKT1 Substrate 1 (Proline-Rich) (AKT1S1))

Alternative Name: AKT1S1 (AKT1S1 Products)

Synonyms: MGC81452 antibody, lobe antibody, pras40 antibody, fb34a04 antibody, wu:fb34a04 antibody, Lobe antibody, PRAS40 antibody, 1110012J22Rik antibody, AI227026 antibody, Lobel antibody, AKT1 substrate 1 (proline rich) S homeolog antibody, AKT1 substrate 1 antibody, AKT1 substrate 1 (proline rich) antibody, AKT1 substrate 1 (proline-rich) antibody, akt1s1.S antibody, AKT1S1 antibody, akt1s1 antibody, Akt1s1 antibody

Background: AKT1S1 may play an important role in phosphatidylinositol 3-kinase (PI3K)-AKT1 survival signaling. It is the substrate for AKT1 phosphorylation, but can also be activated by AKT1-independent mechanisms. Its role in survival signaling pathways may be modulated by oxidative stress.

Molecular Weight: 27 kDa (MW of target protein)

Pathways: Fc-epsilon Receptor Signaling Pathway, EGFR Signaling Pathway, Neurotrophin Signaling Pathway, Regulation of Cell Size, Autophagy, BCR Signaling, Warburg Effect