ARPC3 antibody (N-Term)

Catalog No. ABIN631647

Product Details anti-ARPC3 Antibody

Target: ARPC3 (Actin Related Protein 2/3 Complex, Subunit 3, 21kDa (ARPC3))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ARPC3 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: ARPC3 antibody was raised against the N terminal of ARPC3

Purification: Affinity purified

Immunogen: ARPC3 antibody was raised using the N terminal of ARPC3 corresponding to a region with amino acids MPAYHSSLMDPDTKLIGNMALLPIRSQFKGPAPRETKDTDIVDEAIYYFK

Application Details

Application Notes: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ARPC3 Blocking Peptide, catalog no. 33R-6271, is also available for use as a blocking control in assays to test for specificity of this ARPC3 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ARPC3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ARPC3

Target: ARPC3 (Actin Related Protein 2/3 Complex, Subunit 3, 21kDa (ARPC3))

Alternative Name: ARPC3 (ARPC3 Products)

Synonyms: ARC21 antibody, p21-Arc antibody, 1110006A04Rik antibody, 21kDa antibody, AA408672 antibody, AI788639 antibody, p21-Ar antibody, p21Arc antibody, arc21 antibody, p21-arc antibody, zgc:86828 antibody, actin related protein 2/3 complex subunit 3 antibody, actin related protein 2/3 complex, subunit 3 antibody, actin related protein 2/3 complex subunit 3 L homeolog antibody, actin related protein 2/3 complex, subunit 3, 21kDa antibody, actin related protein 2/3 complex subunit 3 pseudogene antibody, actin-related protein 2/3 complex subunit 3 antibody, actin-related protein 2/3 complex subunit 3 pseudogene antibody, ARPC3 antibody, Arpc3 antibody, arpc3.L antibody, LOC738738 antibody, arpc3 antibody, LOC100036831 antibody, LOC100341254 antibody

Background: ARPC3 is one of seven subunits of the human Arp2/3 protein complex. The Arp2/3 protein complex has been implicated in the control of actin polymerization in cells and has been conserved through evolution. The exact role of the protein, the p21 subunit, has yet to be determined.

Molecular Weight: 20 kDa (MW of target protein)

Pathways: RTK Signaling, Regulation of Actin Filament Polymerization