MPP5 antibody
-
- Target See all MPP5 Antibodies
- MPP5 (Membrane Protein, Palmitoylated 5 (MAGUK P55 Subfamily Member 5) (MPP5))
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This MPP5 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- MPP5 antibody was raised using a synthetic peptide corresponding to a region with amino acids LSLRTQSLKTLRNSDLKPYIIFIAPPSQERLRALLAKEGKNPKPEELREI
- Top Product
- Discover our top product MPP5 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
MPP5 Blocking Peptide, catalog no. 33R-5436, is also available for use as a blocking control in assays to test for specificity of this MPP5 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MPP5 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- MPP5 (Membrane Protein, Palmitoylated 5 (MAGUK P55 Subfamily Member 5) (MPP5))
- Alternative Name
- MPP5 (MPP5 Products)
- Synonyms
- PALS1 antibody, 3830420B02Rik antibody, AI255216 antibody, AI644496 antibody, Pals1 antibody, mpp5 antibody, nok antibody, MAGUK p55 subfamily member 5 antibody, membrane palmitoylated protein 5 antibody, membrane protein, palmitoylated 5 L homeolog antibody, membrane protein, palmitoylated 5 (MAGUK p55 subfamily member 5) antibody, membrane protein, palmitoylated 5a (MAGUK p55 subfamily member 5) antibody, Tsp_03061 antibody, MPP5 antibody, mpp5.L antibody, Mpp5 antibody, mpp5a antibody
- Background
- Members of the peripheral membrane-associated guanylate kinase (MAGUK) family function in tumor suppression and receptor clustering by forming multiprotein complexes containing distinct sets of transmembrane, cytoskeletal, and cytoplasmic signaling proteins.
- Molecular Weight
- 77 kDa (MW of target protein)
- Pathways
- Nucleotide Phosphorylation, Tube Formation, Asymmetric Protein Localization
-