NEDD4 antibody (Middle Region)
-
- Target See all NEDD4 Antibodies
- NEDD4 (Neural Precursor Cell Expressed, Developmentally Down-Regulated 4, E3 Ubiquitin Protein Ligase (NEDD4))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This NEDD4 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- NEDD4 antibody was raised against the middle region of NEDD4
- Purification
- Affinity purified
- Immunogen
- NEDD4 antibody was raised using the middle region of NEDD4 corresponding to a region with amino acids SRRGSLQAYTFEEQPTLPVLLPTSSGLPPGWEEKQDERGRSYYVDHNSRT
- Top Product
- Discover our top product NEDD4 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
NEDD4 Blocking Peptide, catalog no. 33R-8771, is also available for use as a blocking control in assays to test for specificity of this NEDD4 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NEDD4 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- NEDD4 (Neural Precursor Cell Expressed, Developmentally Down-Regulated 4, E3 Ubiquitin Protein Ligase (NEDD4))
- Alternative Name
- NEDD4 (NEDD4 Products)
- Background
- NEDD4 is an E3 ubiquitin-protein ligase which accepts ubiquitin from an E2 ubiquitin-conjugating enzyme in the form of a thioester and then directly transfers the ubiquitin to targeted substrates. NEDD4 is involved in the budding of many viruses.
- Molecular Weight
- 104 kDa (MW of target protein)
- Pathways
- Notch Signaling, Intracellular Steroid Hormone Receptor Signaling Pathway, Skeletal Muscle Fiber Development, Signaling Events mediated by VEGFR1 and VEGFR2
-