CEACAM6 antibody
-
- Target See all CEACAM6 Antibodies
- CEACAM6 (Carcinoembryonic Antigen-Related Cell Adhesion Molecule 6 (CEACAM6))
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This CEACAM6 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- CEACAM6 antibody was raised using a synthetic peptide corresponding to a region with amino acids KLTIESTPFNVAEGKEVLLLAHNLPQNRIGYSWYKGERVDGNSLIVGYVI
- Top Product
- Discover our top product CEACAM6 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
CEACAM6 Blocking Peptide, catalog no. 33R-4544, is also available for use as a blocking control in assays to test for specificity of this CEACAM6 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CEACAM6 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- CEACAM6 (Carcinoembryonic Antigen-Related Cell Adhesion Molecule 6 (CEACAM6))
- Alternative Name
- CEACAM6 (CEACAM6 Products)
- Synonyms
- CD66c antibody, CEAL antibody, NCA antibody, carcinoembryonic antigen-related cell adhesion molecule 6 antibody, carcinoembryonic antigen related cell adhesion molecule 6 antibody, Ceacam6 antibody, CEACAM6 antibody
- Background
- Many breast, pancreatic, colonic and non-small-cell lung carcinoma lines express CEACAM6 and CEACAM5, and antibodies to both can affect tumor cell growth in vitro and in vivo.
- Molecular Weight
- 33 kDa (MW of target protein)
-