ACTN3 antibody (N-Term)

Catalog No. ABIN631674

Product Details anti-ACTN3 Antibody

Target: ACTN3 (Actinin, alpha 3 (ACTN3))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ACTN3 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: Alpha Actinin 3 antibody was raised against the N terminal of ACTN3

Purification: Affinity purified

Immunogen: alpha Actinin 3 antibody was raised using the N terminal of ACTN3 corresponding to a region with amino acids VQNFHTSWKDGLALCALIHRHRPDLIDYAKLRKDDPIGNLNTAFEVAEKY

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Alpha Actinin 3 Blocking Peptide, catalog no. 33R-9753, is also available for use as a blocking control in assays to test for specificity of this Alpha Actinin 3 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ACTN3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ACTN3

Target: ACTN3 (Actinin, alpha 3 (ACTN3))

Alternative Name: alpha Actinin 3 (ACTN3 Products)

Synonyms: CG8953 antibody, Dmel\\CG8953 antibody, ORF1 antibody, acta-3 antibody, dabp antibody, ACTN2 antibody, actn3 antibody, actnl antibody, zgc:63559 antibody, fb95c03 antibody, wu:fb95c03 antibody, wu:fc11d03 antibody, zgc:77243 antibody, actinin alpha 3 (gene/pseudogene) antibody, actinin alpha 3 antibody, alpha actinin 3 antibody, actinin alpha 3a antibody, actinin alpha 3 (gene/pseudogene) L homeolog antibody, alpha-actinin-3 antibody, actinin alpha 3b antibody, ACTN3 antibody, Actn3 antibody, actn3a antibody, actn3.L antibody, actn3 antibody, LOC100439754 antibody, actn3b antibody

Background: Alpha-actinin is an actin-binding protein with multiple roles in different cell types. This protein expression is limited to skeletal muscle. It is localized to the Z-disc and analogous dense bodies, where it helps to anchor the myofibrillar actin filaments.

Molecular Weight: 103 kDa (MW of target protein)

Pathways: Cell-Cell Junction Organization